Recombinant Mouse Cd47 protein, His-tagged CD47-3094M

Recombinant Mouse Cd47 protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Cd47 protein, His-tagged

Recombinant Mouse Cd47 protein, His-tagged

Cd47 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD47-3094M
Product Overview : Recombinant Mouse Cd47(Gln19-Pro158) fused with His tag at C-terminal was expressed in HEK293.
Description : CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Source : HEK293
Species : Mouse
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Protein length : Gln19-Pro158
AA Sequence : QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTS AKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKG GCKLVSWFSPVDHHHHHH
Endotoxin : Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Quality Control Test : 61.3 kDa
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : Cd47 CD47 antigen (Rh-related antigen, integrin-associated signal transducer) [ Mus musculus ]
Official Symbol : Cd47
Synonyms : CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); leukocyte surface antigen CD47; Rh-related antigen; integrin-associated protein; IAP; Itgp; AA407862; AI848868; AW108519; 9130415E20Rik; B430305P08Rik;
Gene ID : 16423
mRNA Refseq : NM_010581
Protein Refseq : NP_034711
UniProt ID : Q61735
Chromosome Location : 16; 16 B5
Pathway : Cell surface interactions at the vascular wall, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hemostasis, organism-specific biosystem; Signal regulatory protein (SIRP) family interactions, organism-specific biosystem;
Function : protein binding; thrombospondin receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy