"Cd47" Related Products

Recombinant Mouse Cd47 protein, His-tagged

Cat.No.: CD47-3094M
Product Overview: Recombinant Mouse Cd47(Gln19-Pro158) fused with His tag at C-terminal was expressed in HEK293.
Description: CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Source: HEK293
Species: Mouse
Tag : His
Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Protein length: Gln19-Pro158
AA Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTS AKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKG GCKLVSWFSPVDHHHHHH
Endotoxin: Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Quality Control Test: 61.3 kDa
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: Cd47 CD47 antigen (Rh-related antigen, integrin-associated signal transducer) [ Mus musculus ]
Official Symbol: Cd47
Synonyms: CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); leukocyte surface antigen CD47; Rh-related antigen; integrin-associated protein; IAP; Itgp; AA407862; AI848868; AW108519; 9130415E20Rik; B430305P08Rik;
Gene ID: 16423
mRNA Refseq: NM_010581
Protein Refseq: NP_034711
UniProt ID: Q61735
Chromosome Location: 16; 16 B5
Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hemostasis, organism-specific biosystem; Signal regulatory protein (SIRP) family interactions, organism-specific biosystem;
Function: protein binding; thrombospondin receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.