Recombinant Mouse CD63 Protein (103-203 aa), GST-tagged
Cat.No. : | CD63-396M |
Product Overview : | Recombinant Mouse CD63 Protein (103-203 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 103-203 aa |
Description : | Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 38.5 kDa |
AA Sequence : | AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Cd63 CD63 antigen [ Mus musculus ] |
Official Symbol | CD63 |
Synonyms | CD63; CD63 antigen; melanoma 1 antigen; ME491; C75951; Tspan30; MGC103180; MGC107286; |
Gene ID | 12512 |
mRNA Refseq | NM_001042580 |
Protein Refseq | NP_001036045 |
UniProt ID | P41731 |
◆ Recombinant Proteins | ||
RFL25099BF | Recombinant Full Length Bovine Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
CD63-180HFL | Recombinant Full Length Human CD63 Protein, C-Flag-tagged | +Inquiry |
CD63-919R | Recombinant Rat CD63 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD63-573R | Recombinant Rhesus Macaque CD63 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd63-2669M | Recombinant Mouse Cd63 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *
0
Inquiry Basket