Recombinant Mouse Cd74 Protein, His-tagged

• Cat.No.: Cd74-1157M
• Product Overview: Recombinant Mouse Cd74 Protein (56-279aa) was expressed in E. coli with N-terminal 6xHis-tag.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 56-279 a.a.
• Description: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 29.5 kDa
• AA Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHV
  MHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTK
  CQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSS
  GLGVTRQELGQVTL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Cd74 CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) [ Mus musculus (house mouse) ]
• Official Symbol: Cd74
• Synonyms: CD74; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); H-2 class II histocompatibility antigen gamma chain; HLA-DR-GAMMA; dinucleotide microsatellite; Ia-associated invariant chain; ia antigen-associated invariant chain; MHC class II-associated invariant chain; class II-associated invariant chain peptide; histocompatibility: class II antigens, gamma chain of; invariant polypeptide of major histocompatibility complex, class II antigen-associated; Ii; CLIP; DHLAG; HLADG; Ia-GAMM
• Gene ID: 16149
• mRNA Refseq: NM_001042605
• Protein Refseq: NP_001036070
• UniProt ID: P04441