Recombinant Mouse Cd74 Protein, His-tagged
Cat.No. : | Cd74-1157M |
Product Overview : | Recombinant Mouse Cd74 Protein (56-279aa) was expressed in E. coli with N-terminal 6xHis-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 56-279 a.a. |
Description : | Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHV MHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTK CQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSS GLGVTRQELGQVTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Cd74 CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) [ Mus musculus (house mouse) ] |
Official Symbol | Cd74 |
Synonyms | CD74; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); H-2 class II histocompatibility antigen gamma chain; HLA-DR-GAMMA; dinucleotide microsatellite; Ia-associated invariant chain; ia antigen-associated invariant chain; MHC class II-associated invariant chain; class II-associated invariant chain peptide; histocompatibility: class II antigens, gamma chain of; invariant polypeptide of major histocompatibility complex, class II antigen-associated; Ii; CLIP; DHLAG; HLADG; Ia-GAMM |
Gene ID | 16149 |
mRNA Refseq | NM_001042605 |
Protein Refseq | NP_001036070 |
UniProt ID | P04441 |
◆ Recombinant Proteins | ||
Cd74-6872R | Recombinant Rat Cd74 protein, His & GST-tagged | +Inquiry |
Cd74-1231M | Recombinant Mouse Cd74 Protein, MYC/DDK-tagged | +Inquiry |
CD74-1262R | Recombinant Rat CD74 Protein | +Inquiry |
Cd74-641M | Active Recombinant Mouse Cd74 Protein, HA-tagged | +Inquiry |
RFL27310MF | Recombinant Full Length Mouse H-2 Class Ii Histocompatibility Antigen Gamma Chain(Cd74) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd74 Products
Required fields are marked with *
My Review for All Cd74 Products
Required fields are marked with *
0
Inquiry Basket