Species : |
Mouse |
Source : |
HEK293 |
Protein Length : |
309 |
Description : |
Predicted to enable signaling receptor binding activity. Involved in several processes, including CD40 signaling pathway; activation of phospholipase C activity; and positive regulation of macromolecule metabolic process. Acts upstream of or within several processes, including cellular response to lipopolysaccharide; defense response to virus; and positive regulation of T cell proliferation. Located in external side of plasma membrane and intracellular membrane-bounded organelle. Is expressed in central nervous system and retina. Used to study Guillain-Barre syndrome. Human ortholog(s) of this gene implicated in several diseases, including Henoch-Schoenlein purpura; autoimmune disease (multiple); chronic lymphocytic leukemia; chronic obstructive pulmonary disease; and systemic scleroderma. Orthologous to human CD86 (CD86 molecule). |
Form : |
Lyophilized |
Molecular Mass : |
27.1 kDa |
AA Sequence : |
MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE |
Purity : |
> 98% |
Applications : |
WB; ELISA; FACS; FC |
Stability : |
This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : |
At -20 centigrade. |
Concentration : |
1 mg/mL |
Storage Buffer : |
PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : |
Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |