Recombinant Mouse CD86 Protein

Name: Recombinant Mouse CD86 Protein
SKU: CD86-596M

Species :	Mouse
Source :	HEK293
Protein Length :	309
Description :	Predicted to enable signaling receptor binding activity. Involved in several processes, including CD40 signaling pathway; activation of phospholipase C activity; and positive regulation of macromolecule metabolic process. Acts upstream of or within several processes, including cellular response to lipopolysaccharide; defense response to virus; and positive regulation of T cell proliferation. Located in external side of plasma membrane and intracellular membrane-bounded organelle. Is expressed in central nervous system and retina. Used to study Guillain-Barre syndrome. Human ortholog(s) of this gene implicated in several diseases, including Henoch-Schoenlein purpura; autoimmune disease (multiple); chronic lymphocytic leukemia; chronic obstructive pulmonary disease; and systemic scleroderma. Orthologous to human CD86 (CD86 molecule).
Form :	Lyophilized
Molecular Mass :	27.1 kDa
AA Sequence :	MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Concentration :	1 mg/mL
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	Cd86 CD86 antigen [ Mus musculus (house mouse) ]
Official Symbol	CD86
Synonyms	CD86; CD86 antigen; T-lymphocyte activation antigen CD86; activation B7-2 antigen; early T cell costimulatory molecule-1; early T-cell costimulatory molecule 1; B7; B70; MB7; B7-2; B7.2; CLS1; Ly58; ETC-1; Ly-58; MB7-2; Cd28l2; TS/A-2;
Gene ID	12524
mRNA Refseq	NM_019388
Protein Refseq	NP_062261
UniProt ID	P42082