Recombinant Mouse CD86 Protein
Cat.No. : | CD86-596M |
Product Overview : | Recombinant Mouse CD86 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 309 |
Description : | Predicted to enable signaling receptor binding activity. Involved in several processes, including CD40 signaling pathway; activation of phospholipase C activity; and positive regulation of macromolecule metabolic process. Acts upstream of or within several processes, including cellular response to lipopolysaccharide; defense response to virus; and positive regulation of T cell proliferation. Located in external side of plasma membrane and intracellular membrane-bounded organelle. Is expressed in central nervous system and retina. Used to study Guillain-Barre syndrome. Human ortholog(s) of this gene implicated in several diseases, including Henoch-Schoenlein purpura; autoimmune disease (multiple); chronic lymphocytic leukemia; chronic obstructive pulmonary disease; and systemic scleroderma. Orthologous to human CD86 (CD86 molecule). |
Form : | Lyophilized |
Molecular Mass : | 27.1 kDa |
AA Sequence : | MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Cd86 CD86 antigen [ Mus musculus (house mouse) ] |
Official Symbol | CD86 |
Synonyms | CD86; CD86 antigen; T-lymphocyte activation antigen CD86; activation B7-2 antigen; early T cell costimulatory molecule-1; early T-cell costimulatory molecule 1; B7; B70; MB7; B7-2; B7.2; CLS1; Ly58; ETC-1; Ly-58; MB7-2; Cd28l2; TS/A-2; |
Gene ID | 12524 |
mRNA Refseq | NM_019388 |
Protein Refseq | NP_062261 |
UniProt ID | P42082 |
◆ Recombinant Proteins | ||
CD86-253H | Recombinant Human CD86 Protein, DYKDDDDK-tagged | +Inquiry |
Cd86-2282MF | Recombinant Mouse Cd86 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
CD86-422H | Recombinant Human CD86 Protein (Met1-His239), His-Fc-tagged, Biotinylated | +Inquiry |
CD86-596M | Recombinant Mouse CD86 Protein | +Inquiry |
CD86-597M | Recombinant Mouse CD86 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD86-1971RCL | Recombinant Rat CD86 cell lysate | +Inquiry |
CD86-1013CCL | Recombinant Cynomolgus CD86 cell lysate | +Inquiry |
CD86-2598MCL | Recombinant Mouse CD86 cell lysate | +Inquiry |
CD86-2619HCL | Recombinant Human CD86 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD86 Products
Required fields are marked with *
My Review for All CD86 Products
Required fields are marked with *
0
Inquiry Basket