Recombinant Mouse Cd99l2 Protein (26-161aa), C-hIgG-His-tagged

• Cat.No.: Cd99l2-02M
• Product Overview: Recombinant mouse CD99-L2 (26-161aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc&His
• Protein Length: 26-161aa
• Description: Acts upstream of or within diapedesis; homotypic cell-cell adhesion; and positive regulation of cellular extravasation. Located in adherens junction and cell surface. Is expressed in several structures, including alimentary system; hemolymphoid system; nervous system; reproductive system; and skin. Orthologous to human CD99L2 (CD99 molecule like 2).
• Form: Liquid
• Molecular Mass: 41.8 kDa (378aa)
• AA Sequence: DTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTRAPANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETG
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Liquid in. Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Cd99l2 CD99 antigen-like 2 [ Mus musculus (house mouse) ]
• Official Symbol: Cd99l2
• Synonyms: CD99L2; CD99 antigen-like 2; CD99 antigen-like protein 2; MIC2 like-1; MIC2-like protein 1; MIC2 (monoclonal Imperial Cancer Research Fund 2)-like 1; Xap89; Mic2l1; AW548191
• Gene ID: 171486
• mRNA Refseq: NM_001199349
• Protein Refseq: NP_001186278
• UniProt ID: Q8BIF0