Recombinant Mouse Cd99l2 Protein (26-161aa), C-hIgG-His-tagged

Cat.No. : Cd99l2-02M
Product Overview : Recombinant mouse CD99-L2 (26-161aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc&His
Protein Length : 26-161aa
Description : Acts upstream of or within diapedesis; homotypic cell-cell adhesion; and positive regulation of cellular extravasation. Located in adherens junction and cell surface. Is expressed in several structures, including alimentary system; hemolymphoid system; nervous system; reproductive system; and skin. Orthologous to human CD99L2 (CD99 molecule like 2).
Form : Liquid
Molecular Mass : 41.8 kDa (378aa)
AA Sequence : DTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTRAPANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETG
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Liquid in. Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Cd99l2 CD99 antigen-like 2 [ Mus musculus (house mouse) ]
Official Symbol Cd99l2
Synonyms CD99L2; CD99 antigen-like 2; CD99 antigen-like protein 2; MIC2 like-1; MIC2-like protein 1; MIC2 (monoclonal Imperial Cancer Research Fund 2)-like 1; Xap89; Mic2l1; AW548191;
Gene ID 171486
mRNA Refseq NM_001199349
Protein Refseq NP_001186278
UniProt ID Q8BIF0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cd99l2 Products

Required fields are marked with *

My Review for All Cd99l2 Products

Required fields are marked with *

0
cart-icon