Recombinant Full Length Human CD99L2 Protein, GST-tagged
Cat.No. : | CD99L2-3107HF |
Product Overview : | Human CD99L2 full-length ORF (AAH25729.1, 1 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 145 amino acids |
Description : | This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKPALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISASVVTWCSPFCVSLLSLTKMLVSGFKAHLDNPG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD99L2 CD99 molecule-like 2 [ Homo sapiens ] |
Official Symbol | CD99L2 |
Synonyms | CD99L2; CD99 molecule-like 2; CD99 antigen like 2, MIC2 like 1, MIC2L1; CD99 antigen-like protein 2; CD99B; MIC2 like 1; MIC2-like protein 1; MIC2L1; DKFZp761H2024; |
Gene ID | 83692 |
mRNA Refseq | NM_001184808 |
Protein Refseq | NP_001171737 |
MIM | 300846 |
UniProt ID | Q8TCZ2 |
◆ Recombinant Proteins | ||
CD99L2-926R | Recombinant Rat CD99L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD99L2-0893H | Recombinant Human CD99L2 Protein, GST-Tagged | +Inquiry |
Cd99l2-02M | Recombinant Mouse Cd99l2 Protein (26-161aa), C-hIgG-His-tagged | +Inquiry |
Cd99l2-3263M | Recombinant Mouse Cd99l2 protein(Met1-Ala164), hFc-tagged | +Inquiry |
RFL4113XF | Recombinant Full Length Xenopus Tropicalis Cd99 Antigen-Like Protein 2(Cd99L2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD99L2-2222MCL | Recombinant Mouse CD99L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD99L2 Products
Required fields are marked with *
My Review for All CD99L2 Products
Required fields are marked with *