| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Enables C-C chemokine binding activity and C-C chemokine receptor activity. Involved in several processes, including leukocyte migration; positive regulation of cell migration; and regulation of cytokine production. Acts upstream of or within several processes, including cellular defense response; monocyte chemotaxis; and neutrophil clearance. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Used to study Coronavirus infectious disease and age related macular degeneration. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; aggressive periodontitis; coronary artery disease (multiple); glucose metabolism disease (multiple); and uveitis (multiple). Orthologous to human CCR2 (C-C motif chemokine receptor 2). |
| Tag : |
N-10×His |
| Molecular Mass : |
48.8 kDa |
| AA Sequence : |
MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPPLYSLVFIFGFVGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVVAVFASLPGIIFTKSKQDDHHYTCGPYFTQLWKNFQTIMRNILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTFQESLGMSNCVIDKHLDQAMQVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKRLCKQCPVFYRETADRVSSTFTPSTGEQEVSVGL |
| Purity : |
> 90 % by SDS-PAGE |
| Storage : |
Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.4 mg/mL |
| Storage Buffer : |
20 mM Tris-HCl, 0.15 M NaCl, 0.05 % FOS12, pH 8.0, 20 % glycerol |
