Recombinant Mouse Clec4g protein, His-tagged
Cat.No. : | Clec4g-2817M |
Product Overview : | Recombinant Mouse Clec4g protein(52-294aa)(Q8BNX1), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 52-294aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | LLSSASSKLRVLLSHQDLLRTNASEQKMTLSSLKDDIGACRNCCSVTKAQLQTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASRDRENIRSELFQALEAVKRQNSSCEQCPPSWLPFQGSCYYFSETQATWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTRGRGYWLGLRAVRHLNKIQGYRWVDGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICEKRSSCY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Clec4g C-type lectin domain family 4, member g [ Mus musculus ] |
Official Symbol | Clec4g |
Synonyms | CLEC4G; C-type lectin domain family 4, member g; C-type lectin domain family 4 member G; 4930572L20Rik; |
Gene ID | 75863 |
mRNA Refseq | NM_029465 |
Protein Refseq | NP_083741 |
◆ Recombinant Proteins | ||
CLEC4G-352H | Recombinant Human CLEC4G protein, Fc-tagged | +Inquiry |
CLEC4G-2685H | Recombinant Human CLEC4G Protein, His (Fc)-Avi-tagged | +Inquiry |
Clec4g-2817M | Recombinant Mouse Clec4g protein, His-tagged | +Inquiry |
CLEC4G-368H | Recombinant Human CLEC4G Protein, Fc-tagged | +Inquiry |
CLEC4G-873H | Active Recombinant Human CLEC4G Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Clec4g Products
Required fields are marked with *
My Review for All Clec4g Products
Required fields are marked with *