Recombinant Mouse CLTRN Protein (15-141 aa), His-SUMO-Myc-tagged
| Cat.No. : | CLTRN-2258M |
| Product Overview : | Recombinant Mouse CLTRN Protein (15-141 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 15-141 aa |
| Description : | Regulator of SNARE complex function. Stimulator of beta cell replication. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 34.5 kDa |
| AA Sequence : | ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Cltrn collectrin, amino acid transport regulator [ Mus musculus (house mouse) ] |
| Official Symbol | CLTRN |
| Synonyms | Cltrn; NX17; NX-17; Tmem27; 0610008J07Rik; |
| Gene ID | 57394 |
| mRNA Refseq | NM_001313719 |
| Protein Refseq | NP_001300648 |
| UniProt ID | Q9ESG4 |
| ◆ Recombinant Proteins | ||
| Cltrn-2201M | Recombinant Mouse Cltrn Protein, Myc/DDK-tagged | +Inquiry |
| CLTRN-2258M | Recombinant Mouse CLTRN Protein (15-141 aa), His-SUMO-Myc-tagged | +Inquiry |
| CLTRN-2173H | Recombinant Human CLTRN Protein (Cys17-Asp137), N-His tagged | +Inquiry |
| CLTRN-5431H | Recombinant Human CLTRN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLTRN Products
Required fields are marked with *
My Review for All CLTRN Products
Required fields are marked with *
