Recombinant Mouse CLTRN Protein (15-141 aa), His-SUMO-Myc-tagged

Cat.No. : CLTRN-2258M
Product Overview : Recombinant Mouse CLTRN Protein (15-141 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 15-141 aa
Description : Regulator of SNARE complex function. Stimulator of beta cell replication.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.5 kDa
AA Sequence : ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Cltrn collectrin, amino acid transport regulator [ Mus musculus (house mouse) ]
Official Symbol CLTRN
Synonyms Cltrn; NX17; NX-17; Tmem27; 0610008J07Rik;
Gene ID 57394
mRNA Refseq NM_001313719
Protein Refseq NP_001300648
UniProt ID Q9ESG4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLTRN Products

Required fields are marked with *

My Review for All CLTRN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon