Recombinant Mouse Cnot7 Protein, His-tagged

• Cat.No.: Cnot7-7306M
• Product Overview: Recombinant mouse CNOT7 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-248
• Description: Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Required for miRNA-mediated mRNA deadenylation. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.
• Form: Liquid
• Molecular Mass: 31.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEASKQS
• Purity: > 80 %
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 1 mM DTT

Gene Information

• Gene Name: Cnot7 CCR4-NOT transcription complex, subunit 7 [ Mus musculus (house mouse) ]
• Official Symbol: Cnot7
• Synonyms: Cnot7; CCR4-NOT transcription complex, subunit 7; Caf; Caf1; Pop2; CAF-1; AU022737; CCR4-NOT transcription complex subunit 7; CCR4-associated factor 1; POP2 homolog; catabolite repressor protein (CCR4)-associative factor 1; EC 3.1.13.4
• Gene ID: 18983
• mRNA Refseq: NM_001271542
• Protein Refseq: NP_001258471
• UniProt ID: Q60809