| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-248 |
| Description : |
Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Required for miRNA-mediated mRNA deadenylation. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity. |
| Form : |
Liquid |
| Molecular Mass : |
31.1 kDa |
| AA Sequence : |
MGSSHHHHHHSSGLVPRGSHMGSMPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEASKQS |
| Purity : |
> 80 % |
| Stability : |
Shelf life: one year from despatch. |
| Storage : |
Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : |
1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : |
20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 1 mM DTT |