Recombinant Human CNOT7 protein, His-tagged
| Cat.No. : | CNOT7-633H | 
| Product Overview : | Recombinant Human CNOT7 protein(Q9UIV1)(1-285aa), fused with N-terminal His tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-285a.a. | 
| Tag : | His | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 36.8 kDa | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS | 
| Gene Name | CNOT7 CCR4-NOT transcription complex, subunit 7 [ Homo sapiens ] | 
| Official Symbol | CNOT7 | 
| Synonyms | CNOT7; CCR4-NOT transcription complex, subunit 7; CAF1; CCR4-NOT transcription complex subunit 7; BTG1 binding factor 1; CAF-1; BTG1-binding factor 1; CCR4-associated factor 1; carbon catabolite repressor protein (CCR4)-associative factor 1; hCAF-1; | 
| Gene ID | 29883 | 
| mRNA Refseq | NM_013354 | 
| Protein Refseq | NP_037486 | 
| MIM | 604913 | 
| UniProt ID | Q9UIV1 | 
| ◆ Recombinant Proteins | ||
| CNOT7-766R | Recombinant Rhesus Macaque CNOT7 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CNOT7-1941HF | Recombinant Full Length Human CNOT7 Protein, GST-tagged | +Inquiry | 
| CNOT7-633H | Recombinant Human CNOT7 protein, His-tagged | +Inquiry | 
| Cnot7-7306M | Recombinant Mouse Cnot7 Protein, His-tagged | +Inquiry | 
| CNOT7-358HFL | Recombinant Full Length Human CNOT7 Protein, C-Flag-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CNOT7-7399HCL | Recombinant Human CNOT7 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT7 Products
Required fields are marked with *
My Review for All CNOT7 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            