Recombinant Human CNOT7 protein, His-tagged
Cat.No. : | CNOT7-633H |
Product Overview : | Recombinant Human CNOT7 protein(Q9UIV1)(1-285aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-285a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS |
Gene Name | CNOT7 CCR4-NOT transcription complex, subunit 7 [ Homo sapiens ] |
Official Symbol | CNOT7 |
Synonyms | CNOT7; CCR4-NOT transcription complex, subunit 7; CAF1; CCR4-NOT transcription complex subunit 7; BTG1 binding factor 1; CAF-1; BTG1-binding factor 1; CCR4-associated factor 1; carbon catabolite repressor protein (CCR4)-associative factor 1; hCAF-1; |
Gene ID | 29883 |
mRNA Refseq | NM_013354 |
Protein Refseq | NP_037486 |
MIM | 604913 |
UniProt ID | Q9UIV1 |
◆ Recombinant Proteins | ||
CNOT7-358HFL | Recombinant Full Length Human CNOT7 Protein, C-Flag-tagged | +Inquiry |
Cnot7-7306M | Recombinant Mouse Cnot7 Protein, His-tagged | +Inquiry |
CNOT7-1594C | Recombinant Chicken CNOT7 | +Inquiry |
CNOT7-4189H | Recombinant Human CNOT7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNOT7-1793H | Recombinant Human CNOT7 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNOT7-7399HCL | Recombinant Human CNOT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT7 Products
Required fields are marked with *
My Review for All CNOT7 Products
Required fields are marked with *