Recombinant Mouse Col4a1 protein(1445-1669aa), His-tagged
Cat.No. : | Col4a1-821M |
Product Overview : | Recombinant Mouse Col4a1 protein(1445-1669aa)(P02463), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1445-1669aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT |
Gene Name | Col4a1 collagen, type IV, alpha 1 [ Mus musculus ] |
Official Symbol | Col4a1 |
Synonyms | COL4A1; collagen, type IV, alpha 1; collagen alpha-1(IV) chain; Del(8)Bru44H; alpha1(IV) collagen; retinal anterior wiring; procollagen, type IV, alpha 1; Bru; Raw; Svc; Col4a-1; Del(8)44H; |
Gene ID | 12826 |
mRNA Refseq | NM_009931 |
Protein Refseq | NP_034061 |
◆ Recombinant Proteins | ||
COL4A1-5269H | Recombinant Human COL4A1 protein, GST-tagged | +Inquiry |
COL4A1-3735M | Recombinant Mouse COL4A1 Protein | +Inquiry |
COL4A1-611H | Recombinant Human COL4A1 protein, His & S-tagged | +Inquiry |
COL4A1-819C | Recombinant Cattle COL4A1 Protein, His-tagged | +Inquiry |
Col4a1-820M | Recombinant Mouse Col4a1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Col4a1 Products
Required fields are marked with *
My Review for All Col4a1 Products
Required fields are marked with *