Recombinant Mouse Col4a1 protein(1445-1669aa), His-tagged

Cat.No. : Col4a1-821M
Product Overview : Recombinant Mouse Col4a1 protein(1445-1669aa)(P02463), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1445-1669aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.8 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
Gene Name Col4a1 collagen, type IV, alpha 1 [ Mus musculus ]
Official Symbol Col4a1
Synonyms COL4A1; collagen, type IV, alpha 1; collagen alpha-1(IV) chain; Del(8)Bru44H; alpha1(IV) collagen; retinal anterior wiring; procollagen, type IV, alpha 1; Bru; Raw; Svc; Col4a-1; Del(8)44H;
Gene ID 12826
mRNA Refseq NM_009931
Protein Refseq NP_034061

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Col4a1 Products

Required fields are marked with *

My Review for All Col4a1 Products

Required fields are marked with *

0
cart-icon
0
compare icon