Recombinant Mouse Creb5 protein, His-tagged

• Cat.No.: Creb5-5532M
• Product Overview: Recombinant Mouse Creb5 protein(Q8K1L0)(1-357aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-357a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.1 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPHHHLHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL

Gene Information

• Gene Name: Creb5 cAMP responsive element binding protein 5 [ Mus musculus ]
• Official Symbol: Creb5
• Synonyms: CREB5; cAMP responsive element binding protein 5; cyclic AMP-responsive element-binding protein 5; CREB-5; CRE-BPa; cAMP-responsive element-binding protein 5; Crebpa; D430026C09Rik
• Gene ID: 231991
• mRNA Refseq: NM_172728
• Protein Refseq: NP_766316