Recombinant Mouse Crtac1 protein, hFc-SBP-tagged

• Cat.No.: Crtac1-4535M
• Product Overview: Recombinant Mouse Crtac1 protein(Q8R555)(29-606 aa), fused with N-terminal hFc and SBP tag, was expressed in Mammalian Cells.

Specification

• Species: Mouse
• Source: Mammalian Cells
• Tag: Fc
• Protein Length: 29-606 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 95.5 kDa
• AASequence: SQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYTGPNLVLKYNRAQNRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDDVNVARGVASLFAGRSVACVDRTGSGRYSIYIANYAYGDVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTAGRGVSVGPILSSSASDIFCDNENGPNFLFHNQGNGTFVDTAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSAHGKVRFRDIASPKFSTPSPVRTVIAADFDNDQELEVFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFSNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGRDEASSVEVTWPDGKMVSRSVASEEMNSVLEILYPQDEDKLQNTAPLECGQGFSQQDNGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCNRGYEPNEDGTAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Crtac1 cartilage acidic protein 1 [ Mus musculus ]
• Official Symbol: Crtac1
• Synonyms: CRTAC1; cartilage acidic protein 1; ASPIC; CEP-68; protein CRTAC1-B; 68 kDa chondrocyte-expressed protein; Lotus; Crtac1B; AW047536; 2810454P21Rik
• Gene ID: 72832
• mRNA Refseq: NM_145123
• Protein Refseq: NP_660105