Recombinant Mouse Csf2 Protein
| Cat.No. : | Csf2-7180M |
| Product Overview : | Recombinant Mouse Csf2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Protein Length : | 18-141 |
| Description : | Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. |
| Form : | Liquid |
| Molecular Mass : | 14 kDa |
| AA Sequence : | MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK |
| Purity : | > 95 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
| Gene Name | Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ] |
| Official Symbol | Csf2 |
| Synonyms | Csf2; colony stimulating factor 2 (granulocyte-macrophage); CSF; Csfg; GMCS; Csfgm; GMCSF; Gm-CS; MGI-I; Gm-CSf; MGI-IGM; granulocyte-macrophage colony-stimulating factor; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; put. GM-CSF |
| Gene ID | 12981 |
| mRNA Refseq | NM_009969 |
| Protein Refseq | NP_034099 |
| UniProt ID | P01587 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Csf2 Products
Required fields are marked with *
My Review for All Csf2 Products
Required fields are marked with *



