Recombinant Mouse Csf2 Protein
Cat.No. : | Csf2-7180M |
Product Overview : | Recombinant Mouse Csf2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 18-141 |
Description : | Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. |
Form : | Liquid |
Molecular Mass : | 14 kDa |
AA Sequence : | MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ] |
Official Symbol | Csf2 |
Synonyms | Csf2; colony stimulating factor 2 (granulocyte-macrophage); CSF; Csfg; GMCS; Csfgm; GMCSF; Gm-CS; MGI-I; Gm-CSf; MGI-IGM; granulocyte-macrophage colony-stimulating factor; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; put. GM-CSF |
Gene ID | 12981 |
mRNA Refseq | NM_009969 |
Protein Refseq | NP_034099 |
UniProt ID | P01587 |
◆ Recombinant Proteins | ||
CSF2-207P | Active Recombinant Pig CSF2 Protein (Ala18-Lys144), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Csf2-8907R | Active Recombinant Rat Csf2 | +Inquiry |
CSF2-155C | Active Recombinant Human CSF2 Protein | +Inquiry |
Csf2-49M | Recombinant Active Mouse CSF2 Protein, His-tagged(N-ter) | +Inquiry |
CSF2-106S | Recombinant Swine CSF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Csf2 Products
Required fields are marked with *
My Review for All Csf2 Products
Required fields are marked with *