Recombinant Mouse Cst3 Protein, His-tagged

Cat.No. : Cst3-7182M
Product Overview : Recombinant Mouse Cst3 protein with a His tag was expressed in insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 21-140
Description : The protein encoded by this gene is a cysteine protease inhibitor involved in neurodegenerative and cardiovascular processes. The encoded protein inhibits aggregation of beta-amyloid protein, a hallmark of Alzheimer's disease, so it may be useful as a therapeutic. This protein also may be a biomarker for atherosclerosis.
Form : Liquid
Molecular Mass : 14.2 kDa
AA Sequence : ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNAHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Cst3 cystatin C [ Mus musculus (house mouse) ]
Official Symbol Cst3
Synonyms Cst3; cystatin C; Cys; CysC; cystatin-C; cystatin-3
Gene ID 13010
mRNA Refseq NM_009976
Protein Refseq NP_034106
UniProt ID P21460

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cst3 Products

Required fields are marked with *

My Review for All Cst3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon