Recombinant Mouse Cst3 Protein, His-tagged
Cat.No. : | Cst3-7182M |
Product Overview : | Recombinant Mouse Cst3 protein with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 21-140 |
Description : | The protein encoded by this gene is a cysteine protease inhibitor involved in neurodegenerative and cardiovascular processes. The encoded protein inhibits aggregation of beta-amyloid protein, a hallmark of Alzheimer's disease, so it may be useful as a therapeutic. This protein also may be a biomarker for atherosclerosis. |
Form : | Liquid |
Molecular Mass : | 14.2 kDa |
AA Sequence : | ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNAHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Cst3 cystatin C [ Mus musculus (house mouse) ] |
Official Symbol | Cst3 |
Synonyms | Cst3; cystatin C; Cys; CysC; cystatin-C; cystatin-3 |
Gene ID | 13010 |
mRNA Refseq | NM_009976 |
Protein Refseq | NP_034106 |
UniProt ID | P21460 |
◆ Recombinant Proteins | ||
CST3-376H | Recombinant Human CST3 protein | +Inquiry |
CST3-1303R | Recombinant Rat CST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cst3-4094R | Recombinant Rat Cst3 protein, His-tagged | +Inquiry |
CST3-11643H | Recombinant Human CST3, GST-tagged | +Inquiry |
CST3-1645R | Recombinant Rat CST3 Protein | +Inquiry |
◆ Native Proteins | ||
CST3-4309H | Native Human CST3 Protein | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST3-2991HCL | Recombinant Human CST3 cell lysate | +Inquiry |
CST3-1938RCL | Recombinant Rat CST3 cell lysate | +Inquiry |
CST3-2470MCL | Recombinant Mouse CST3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cst3 Products
Required fields are marked with *
My Review for All Cst3 Products
Required fields are marked with *