Recombinant Mouse Cst3 Protein, His-tagged
| Cat.No. : | Cst3-7182M |
| Product Overview : | Recombinant Mouse Cst3 protein with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 21-140 |
| Description : | The protein encoded by this gene is a cysteine protease inhibitor involved in neurodegenerative and cardiovascular processes. The encoded protein inhibits aggregation of beta-amyloid protein, a hallmark of Alzheimer's disease, so it may be useful as a therapeutic. This protein also may be a biomarker for atherosclerosis. |
| Form : | Liquid |
| Molecular Mass : | 14.2 kDa |
| AA Sequence : | ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNAHHHHHH |
| Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
| Purity : | > 95 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
| Gene Name | Cst3 cystatin C [ Mus musculus (house mouse) ] |
| Official Symbol | Cst3 |
| Synonyms | Cst3; cystatin C; Cys; CysC; cystatin-C; cystatin-3 |
| Gene ID | 13010 |
| mRNA Refseq | NM_009976 |
| Protein Refseq | NP_034106 |
| UniProt ID | P21460 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cst3 Products
Required fields are marked with *
My Review for All Cst3 Products
Required fields are marked with *



