Recombinant Mouse Cst3 Protein, His-tagged

• Cat.No.: Cst3-7182M
• Product Overview: Recombinant Mouse Cst3 protein with a His tag was expressed in insect cells.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 21-140
• Description: The protein encoded by this gene is a cysteine protease inhibitor involved in neurodegenerative and cardiovascular processes. The encoded protein inhibits aggregation of beta-amyloid protein, a hallmark of Alzheimer's disease, so it may be useful as a therapeutic. This protein also may be a biomarker for atherosclerosis.
• Form: Liquid
• Molecular Mass: 14.2 kDa
• AA Sequence: ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNAHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Cst3 cystatin C [ Mus musculus (house mouse) ]
• Official Symbol: Cst3
• Synonyms: Cst3; cystatin C; Cys; CysC; cystatin-C; cystatin-3
• Gene ID: 13010
• mRNA Refseq: NM_009976
• Protein Refseq: NP_034106
• UniProt ID: P21460