Recombinant Mouse CTDP1 Protein (178-341 aa), His-Myc-tagged

Cat.No. : CTDP1-2204M
Product Overview : Recombinant Mouse CTDP1 Protein (178-341 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 178-341 aa
Description : Processively dephosphorylates 'Ser-2' and 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This promotes the activity of RNA polymerase II. Plays a role in the exit from mitosis by dephosphorylating crucial mitotic substrates (USP44, CDC20 and WEE1) that are required for M-phase-promoting factor (MPF)/CDK1 inactivation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.0 kDa
AA Sequence : HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Ctdp1 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 [ Mus musculus ]
Official Symbol CTDP1
Synonyms CTDP1; TFIIF-associating CTD phosphatase; AW553592; 4930563P03Rik;
Gene ID 67655
mRNA Refseq NM_026295
Protein Refseq NP_080571
UniProt ID Q7TSG2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTDP1 Products

Required fields are marked with *

My Review for All CTDP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon