Recombinant Mouse CTDP1 Protein (178-341 aa), His-Myc-tagged

• Cat.No.: CTDP1-2204M
• Product Overview: Recombinant Mouse CTDP1 Protein (178-341 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 178-341 aa
• Description: Processively dephosphorylates 'Ser-2' and 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This promotes the activity of RNA polymerase II. Plays a role in the exit from mitosis by dephosphorylating crucial mitotic substrates (USP44, CDC20 and WEE1) that are required for M-phase-promoting factor (MPF)/CDK1 inactivation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.0 kDa
• AA Sequence: HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Ctdp1 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 [ Mus musculus ]
• Official Symbol: CTDP1
• Synonyms: CTDP1; TFIIF-associating CTD phosphatase; AW553592; 4930563P03Rik
• Gene ID: 67655
• mRNA Refseq: NM_026295
• Protein Refseq: NP_080571
• UniProt ID: Q7TSG2