Recombinant Mouse CTDP1 Protein (178-341 aa), His-Myc-tagged
Cat.No. : | CTDP1-2204M |
Product Overview : | Recombinant Mouse CTDP1 Protein (178-341 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 178-341 aa |
Description : | Processively dephosphorylates 'Ser-2' and 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This promotes the activity of RNA polymerase II. Plays a role in the exit from mitosis by dephosphorylating crucial mitotic substrates (USP44, CDC20 and WEE1) that are required for M-phase-promoting factor (MPF)/CDK1 inactivation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.0 kDa |
AA Sequence : | HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Ctdp1 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 [ Mus musculus ] |
Official Symbol | CTDP1 |
Synonyms | CTDP1; TFIIF-associating CTD phosphatase; AW553592; 4930563P03Rik; |
Gene ID | 67655 |
mRNA Refseq | NM_026295 |
Protein Refseq | NP_080571 |
UniProt ID | Q7TSG2 |
◆ Recombinant Proteins | ||
CTDP1-861Z | Recombinant Zebrafish CTDP1 | +Inquiry |
CTDP1-4016M | Recombinant Mouse CTDP1 Protein | +Inquiry |
CTDP1-2059H | Recombinant Human CTDP1 Protein, GST-tagged | +Inquiry |
CTDP1-2204M | Recombinant Mouse CTDP1 Protein (178-341 aa), His-Myc-tagged | +Inquiry |
CTDP1-2046M | Recombinant Mouse CTDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTDP1 Products
Required fields are marked with *
My Review for All CTDP1 Products
Required fields are marked with *