Recombinant Mouse CTLA4 Protein

• Cat.No.: CTLA4-653M
• Product Overview: Recombinant Mouse CTLA4 protein without tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Protein Length: 223
• Description: This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Form: Lyophilized
• Molecular Mass: 15.9 kDa
• AA Sequence: MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus (house mouse) ]
• Official Symbol: CTLA4
• Synonyms: CTLA4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4; Cd152; Ly-56; Ctla-4
• Gene ID: 12477
• mRNA Refseq: NM_009843
• Protein Refseq: NP_033973
• UniProt ID: P09793