Recombinant Mouse CTLA4 Protein
Cat.No. : | CTLA4-653M |
Product Overview : | Recombinant Mouse CTLA4 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 223 |
Description : | This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | Lyophilized |
Molecular Mass : | 15.9 kDa |
AA Sequence : | MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus (house mouse) ] |
Official Symbol | CTLA4 |
Synonyms | CTLA4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4; Cd152; Ly-56; Ctla-4; |
Gene ID | 12477 |
mRNA Refseq | NM_009843 |
Protein Refseq | NP_033973 |
UniProt ID | P09793 |
◆ Recombinant Proteins | ||
CTLA4-593H | Active Recombinant Human CTLA4, Fc-tagged, Biotinylated | +Inquiry |
CTLA4-255H | Recombinant Human CTLA4, His-tagged, Biotinylated | +Inquiry |
Ctla4-5840R | Recombinant Rat Ctla4 protein, His & T7-tagged | +Inquiry |
CTLA4-8852CF | Active Recombinant Monkey CTLA4 Protein, Fc-tagged, FITC conjugated | +Inquiry |
CTLA4-109CAF488 | Active Recombinant Cynomolgus CTLA4 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTLA4 Products
Required fields are marked with *
My Review for All CTLA4 Products
Required fields are marked with *
0
Inquiry Basket