Recombinant Mouse Ctla4 protein, His-SUMO & Myc-tagged
| Cat.No. : | Ctla4-2755M |
| Product Overview : | Recombinant Mouse Ctla4 protein(P09793)(36-161aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 36-161aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.9 kDa |
| AA Sequence : | EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus ] |
| Official Symbol | Ctla4 |
| Synonyms | CTLA4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4; Cd152; Ly-56; Ctla-4; |
| Gene ID | 12477 |
| mRNA Refseq | NM_009843 |
| Protein Refseq | NP_033973 |
| ◆ Recombinant Proteins | ||
| CTLA4-8852CAF555 | Active Recombinant Monkey CTLA4 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| Ctla4-3307M | Active Recombinant Mouse Ctla4 protein(Met1-Phe162), His-tagged | +Inquiry |
| CTLA4-8722H | Recombinant Human CTLA4 protein, His-tagged (MALS verified) | +Inquiry |
| CTLA4-870H | Recombinant Human CTLA4 Protein, His&SUMO-tagged | +Inquiry |
| CTLA4-1913H | Recombinant Human CTLA4, Fc Chimera | +Inquiry |
| ◆ Native Proteins | ||
| CTLA4-36M | Active Recombinant Mouse CTLA4 Homodimer Protein, His tagged | +Inquiry |
| CTLA4-35H | Active Recombinant Human CTLA4 Homodimer Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
| CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
| CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctla4 Products
Required fields are marked with *
My Review for All Ctla4 Products
Required fields are marked with *
