Recombinant Mouse Ctsc protein, His&Myc-tagged
Cat.No. : | Ctsc-3422M |
Product Overview : | Recombinant Mouse Ctsc protein(P97821)(25-134aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 25-134aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNW |
Gene Name | Ctsc cathepsin C [ Mus musculus ] |
Official Symbol | Ctsc |
Synonyms | CTSC; cathepsin C; dipeptidyl peptidase 1; DPP-I; cathepsin J; dipeptidylpeptidase 1; dipeptidyl peptidase I; dipeptidyl transferase; dipeptidyl-peptidase 1; dipeptidyl-peptidase I; DPP1; DPPI; AI047818; |
Gene ID | 13032 |
mRNA Refseq | NM_009982 |
Protein Refseq | NP_034112 |
◆ Recombinant Proteins | ||
CTSC-3367H | Recombinant Human CTSC Protein, MYC/DDK-tagged | +Inquiry |
CTSC-1087R | Recombinant Rhesus monkey CTSC Protein, His-tagged | +Inquiry |
CTSC-2333HF | Recombinant Full Length Human CTSC Protein, GST-tagged | +Inquiry |
Ctsc-2368M | Recombinant Mouse Ctsc Protein, Myc/DDK-tagged | +Inquiry |
CTSC-912R | Recombinant Rhesus Macaque CTSC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSC-3024HCL | Recombinant Human CTSC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsc Products
Required fields are marked with *
My Review for All Ctsc Products
Required fields are marked with *
0
Inquiry Basket