Recombinant Mouse Ctsd Protein, His-tagged
| Cat.No. : | Ctsd-2369M |
| Product Overview : | Purified recombinant protein of Mouse cathepsin D (Ctsd) with a C-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Description : | Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation. |
| Molecular Mass : | 43.9 kDa |
| AA Sequence : | IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLVDHHHHHH |
| Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
| Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5 |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/mL. Dissolve the lyophilized protein in 1×PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | Ctsd cathepsin D [ Mus musculus (house mouse) ] |
| Official Symbol | Ctsd |
| Synonyms | CTSD; cathepsin D; CD; CatD |
| Gene ID | 13033 |
| mRNA Refseq | NM_009983 |
| Protein Refseq | NP_034113 |
| UniProt ID | P18242 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsd Products
Required fields are marked with *
My Review for All Ctsd Products
Required fields are marked with *
