Recombinant Mouse Ctsd Protein, His-tagged
Cat.No. : | Ctsd-2369M |
Product Overview : | Purified recombinant protein of Mouse cathepsin D (Ctsd) with a C-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Description : | Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation. |
Molecular Mass : | 43.9 kDa |
AA Sequence : | IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLVDHHHHHH |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/mL. Dissolve the lyophilized protein in 1×PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Ctsd cathepsin D [ Mus musculus (house mouse) ] |
Official Symbol | Ctsd |
Synonyms | CTSD; cathepsin D; CD; CatD |
Gene ID | 13033 |
mRNA Refseq | NM_009983 |
Protein Refseq | NP_034113 |
UniProt ID | P18242 |
◆ Recombinant Proteins | ||
CTSD-435C | Recombinant Cricetulus Griseus CTSD Protein (65-408 aa), His-SUMO-tagged | +Inquiry |
CTSD-2757H | Recombinant Human CTSD protein, His-tagged | +Inquiry |
CTSD-1058H | Recombinant Human CTSD Protein (Leu21-Leu412), C-His tagged | +Inquiry |
CTSD-522H | Recombinant Human CTSD protein, His-tagged | +Inquiry |
CTSD-04H | Active Recombinant Human CTSD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsd Products
Required fields are marked with *
My Review for All Ctsd Products
Required fields are marked with *
0
Inquiry Basket