| Species : |
Mouse |
| Tag : |
His |
| Protein Length : |
21-340 (325aa) |
| Description : |
This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. Alternative splicing results in multiple transcript variants, which encode preproproteins that are proteolytically processed to generate mature protein products. This enzyme is secreted by antigen-presenting cells during inflammation and may induce pain and itch via activation of G-protein coupled receptors. Homozygous knockout mice for this gene exhibit impaired wound healing, reduced tumorigenesis in a pancreatic cancer model, and reduced pathogenesis in a myasthenia gravis model. |
| Form : |
Liquid |
| Molecular Mass : |
36.9 kDa |
| AA Sequence : |
EQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEISCRMGALRISRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEILEHHHHHHDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEILEHHHHHH |
| Endotoxin : |
< 1.0 EU/μg of protein (determined by LAL method) |
| Purity : |
> 90 % by SDS-PAGE |
| Stability : |
Shelf life: one year from despatch. |
| Storage : |
Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : |
0.5 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : |
Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |