Recombinant Mouse Cxcl10 protein, GST-tagged
Cat.No. : | Cxcl10-2770M |
Product Overview : | Recombinant Mouse Cxcl10 protein(P17515)(22-98aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 22-98aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cxcl10 chemokine (C-X-C motif) ligand 10 [ Mus musculus ] |
Official Symbol | Cxcl10 |
Synonyms | CXCL10; chemokine (C-X-C motif) ligand 10; C-X-C motif chemokine 10; gamma-IP10; interferon activated gene 10; small-inducible cytokine B10; interferon-gamma induced protein CRG-2; interferon-gamma-induced protein CRG-2; 10 kDa interferon gamma-induced protein; small inducible cytokine B subfamily (Cys-X-Cys), member 10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10; |
Gene ID | 15945 |
mRNA Refseq | NM_021274 |
Protein Refseq | NP_067249 |
◆ Recombinant Proteins | ||
CXCL10-101H | Recombinant Human CXCL10 Protein, DYKDDDDK-tagged | +Inquiry |
Cxcl10-526R | Recombinant Rat Cxcl10 Protein, His-tagged | +Inquiry |
CXCL10-050H | Recombinant Human CXCL10 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CXCL10-54G | Recombinant Guinea Pig CXCL10 Protein | +Inquiry |
CXCL10-4648R | Recombinant Rhesus macaque CXCL10 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl10 Products
Required fields are marked with *
My Review for All Cxcl10 Products
Required fields are marked with *