Recombinant Mouse Cxcl14 protein

Cat.No. : Cxcl14-614M
Product Overview : Recombinant Mouse Cxcl14 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 77
Description : Chemokine (C-X-C motif) ligand 14 (CXCL14), also named BRAK, is a small cytokine belonging to the CXC chemokine family. It is constitutively expressed at the mRNA level in certain normal tissues and it possesses chemoattractive activity for activated macrophages, immature dendritic cells and natural killer cells. According to the relevant literature, CXCL14 is associated with tumor development. Moreover, recent evidence revealed that CXCL14 participates in glucose metabolism, feeding behaviour-associated neuronal circuits, and anti-microbial defense. Although CXCL14 receptors have not yet been identified, the intracellular activity of CXCL14 in breast cancer cells suggests that the CXCL14 receptor(s) and signal transduction pathway(s) may be different from those of conventional CXC-type chemokines. Recombinant murine CXCL14 contains 77 amino acid residues and it shares 97 % and 99 % a.a. sequence identity with human and rat CXCL14.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, 400 mM NaCl, pH 7.4, 5 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Molecular Mass : Approximately 9.4 kDa, a single non-glycosylated polypeptide chain containing 77amino acids.
AA Sequence : SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Endotoxin : Less than 1 EU/μg of rMuBRAK/CXCL14 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cxcl14
Official Symbol Cxcl14
Synonyms CXCL14; chemokine (C-X-C motif) ligand 14; C-X-C motif chemokine 14; chemokine BRAK; small-inducible cytokine B14; kidney-expressed chemokine CXC; musculus CXC chemokine MIP-2gamma; B-cell and monocyte-activating chemokine; small inducible cytokine subfamily B (Cys-X-Cys), member 14; KS1; Kec; BMAC; BRAK; NJAC; MIP-2g; Scyb14; AI414372; bolekine; MIP2gamma; 1110031L23Rik; 1200006I23Rik; MGC90667;
Gene ID 57266
mRNA Refseq NM_019568
Protein Refseq NP_062514
UniProt ID Q9WUQ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl14 Products

Required fields are marked with *

My Review for All Cxcl14 Products

Required fields are marked with *

0
cart-icon