Recombinant Mouse Cxcl2 protein
Cat.No. : | Cxcl2-2169M |
Product Overview : | Recombinant Mouse Cxcl2 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 73 |
Description : | Murine CXCL2, also named MIP-2, is belonging to the CXC chemokine family. It is encoded by the gene CXCL2. CXCL2 shares 90 % amino acid sequence with CXCL1/GROα. It is member of the intercrine alpha (chemokine C-X-C) subfamily of chemokines. This chemokine is secreted from a murine macrophage cell line. The functional receptor for CXCL2 has been identified as CXCR2. CXCL2 is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. Similar to other GRO proteins, CXCL2 is potent neutrophil attractants and activators. In addition, it is also active toward basophils. The amino acid sequence of murine CXCL2 is 60 % identical to human CXCL2. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 1.0-10 ng/ml. |
Molecular Mass : | Approximately 7.8 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
Endotoxin : | Less than 1 EU/μg of rMuMIP-2/CXCL2 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Cxcl2 |
Official Symbol | Cxcl2 |
Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a; |
Gene ID | 20310 |
mRNA Refseq | NM_009140 |
Protein Refseq | NP_033166 |
UniProt ID | P10889 |
◆ Recombinant Proteins | ||
CXCL2-17H | Active Recombinant Human CXCL2 | +Inquiry |
Cxcl2-2169M | Recombinant Mouse Cxcl2 protein | +Inquiry |
CXCL2-2165P | Recombinant CXCL2 Protein, His-Flag-StrepII-tagged | +Inquiry |
Cxcl2-38M | Recombinant Mouse Chemokine (C-X-C Motif) Ligand 2 | +Inquiry |
CXCL2-282H | Recombinant Human CXCL2, StrepII-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl2 Products
Required fields are marked with *
My Review for All Cxcl2 Products
Required fields are marked with *
0
Inquiry Basket