Recombinant Mouse Cxcr2 Full Length Transmembrane protein, His-tagged
Cat.No. : | Cxcr2-1314M |
Product Overview : | Recombinant Mouse Cxcr2 protein(P35343)(1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-359aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.2 kDa |
AA Sequence : | MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINSYAVVVIYVLVTLL SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWTFGSTLCKI FSYVKEVTFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCIAMWLLSVILALPIL ILRNPVKVNLSTLVCYEDVGNNTSRLRVVLRILPQTFGFLVPLLIMLFCYGFTLRTLFKA HMGQKHRAMRVIFAVVLVFLLCWLPYNLVLFTDTLMRTKLIKETCERRDDIDKALNATEI LGFLHSCLNPIIYAFIGQKFRHGLLKIMATYGLVSKEFLAKEGRPSFVSSSSANTSTTL |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cxcr2 chemokine (C-X-C motif) receptor 2 [ Mus musculus ] |
Official Symbol | Cxcr2 |
Synonyms | CXCR2; chemokine (C-X-C motif) receptor 2; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; IL-8R B; GRO/MGSA receptor; IL-8 receptor alpha chain; chemokine (C-X-C) receptor 2; interleukin 8 receptor, beta; interleukin-8 receptor type B; high affinity interleukin-8 receptor B; CD128; IL8RA; Il8rb; CDw128; Cmkar2; Gpcr16; IL-8Rh; IL-8rb; mIL-8RH; |
Gene ID | 12765 |
mRNA Refseq | NM_009909 |
Protein Refseq | NP_034039 |
◆ Recombinant Proteins | ||
CXCR2-106HF | Recombinant Full Length Human CXCR2 Protein | +Inquiry |
CXCR2-1352R | Recombinant Rat CXCR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR2-2179H | Recombinant Human CXCR2 Protein, GST-tagged | +Inquiry |
CXCR2-16H | Recombinant Human CXCR2 protein, MYC/DDK-tagged | +Inquiry |
RFL56OF | Recombinant Full Length Rabbit C-X-C Chemokine Receptor Type 2(Cxcr2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcr2 Products
Required fields are marked with *
My Review for All Cxcr2 Products
Required fields are marked with *