Recombinant Mouse Cxcr3 protein, His-KSI-tagged

Cat.No. : Cxcr3-2779M
Product Overview : Recombinant Mouse Cxcr3 protein(O88410)(1-52aa), fused to N-terminal His tag and KSI tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&KSI
Protein Length : 1-52aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 21.3 kDa
AA Sequence : MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Cxcr3 chemokine (C-X-C motif) receptor 3 [ Mus musculus ]
Official Symbol Cxcr3
Synonyms CXCR3; chemokine (C-X-C motif) receptor 3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; IP-10 receptor; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; Cd183; Cmkar3;
Gene ID 12766
mRNA Refseq NM_009910
Protein Refseq NP_034040

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcr3 Products

Required fields are marked with *

My Review for All Cxcr3 Products

Required fields are marked with *

0
cart-icon