Recombinant Mouse Cxcr3 protein, His-KSI-tagged
Cat.No. : | Cxcr3-2779M |
Product Overview : | Recombinant Mouse Cxcr3 protein(O88410)(1-52aa), fused to N-terminal His tag and KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 1-52aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.3 kDa |
AA Sequence : | MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cxcr3 chemokine (C-X-C motif) receptor 3 [ Mus musculus ] |
Official Symbol | Cxcr3 |
Synonyms | CXCR3; chemokine (C-X-C motif) receptor 3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; IP-10 receptor; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; Cd183; Cmkar3; |
Gene ID | 12766 |
mRNA Refseq | NM_009910 |
Protein Refseq | NP_034040 |
◆ Recombinant Proteins | ||
CXCR3-1353R | Recombinant Rat CXCR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR3-1082HFL | Active Recombinant Human CXCR3 Full Length Transmembrane protein | +Inquiry |
CXCR3-28064TH | Recombinant Human CXCR3, GST-tagged | +Inquiry |
RFL7402CF | Recombinant Full Length Goat C-X-C Chemokine Receptor Type 3(Cxcr3) Protein, His-Tagged | +Inquiry |
Cxcr3-2779M | Recombinant Mouse Cxcr3 protein, His-KSI-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR3-7162HCL | Recombinant Human CXCR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcr3 Products
Required fields are marked with *
My Review for All Cxcr3 Products
Required fields are marked with *