Recombinant Mouse Cxcr3 protein, His-KSI-tagged

• Cat.No.: Cxcr3-2779M
• Product Overview: Recombinant Mouse Cxcr3 protein(O88410)(1-52aa), fused to N-terminal His tag and KSI tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&KSI
• Protein Length: 1-52aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.3 kDa
• AA Sequence: MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Cxcr3 chemokine (C-X-C motif) receptor 3 [ Mus musculus ]
• Official Symbol: Cxcr3
• Synonyms: CXCR3; chemokine (C-X-C motif) receptor 3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; IP-10 receptor; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; Cd183; Cmkar3
• Gene ID: 12766
• mRNA Refseq: NM_009910
• Protein Refseq: NP_034040