Recombinant Mouse DBIL5 Protein (1-87 aa), His-tagged
| Cat.No. : | DBIL5-2426M |
| Product Overview : | Recombinant Mouse DBIL5 Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-87 aa |
| Description : | May be involved in the energy metabolism of the mature sperm. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 13.9 kDa |
| AA Sequence : | MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Dbil5 diazepam binding inhibitor-like 5 [ Mus musculus (house mouse) ] |
| Official Symbol | DBIL5 |
| Synonyms | Dbil5; ELP; |
| Gene ID | 13168 |
| mRNA Refseq | NM_021294 |
| Protein Refseq | NP_067269 |
| UniProt ID | O09035 |
| ◆ Recombinant Proteins | ||
| DBIL5-2426M | Recombinant Mouse DBIL5 Protein (1-87 aa), His-tagged | +Inquiry |
| DBIL5-1438R | Recombinant Rat DBIL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DBIL5-2209M | Recombinant Mouse DBIL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DBIL5-1780R | Recombinant Rat DBIL5 Protein | +Inquiry |
| DBIL5-4318M | Recombinant Mouse DBIL5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBIL5 Products
Required fields are marked with *
My Review for All DBIL5 Products
Required fields are marked with *



