Recombinant Mouse DCN Protein (35-354 aa), His-tagged
Cat.No. : | DCN-1377M |
Product Overview : | Recombinant Mouse DCN Protein (35-354 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 35-354 aa |
Description : | May affect the rate of fibrils formation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.9 kDa |
AA Sequence : | GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Dcn decorin [ Mus musculus ] |
Official Symbol | DCN |
Synonyms | DCN; decorin; DC; PG40; PGII; PGS2; mDcn; DSPG2; SLRR1B; |
Gene ID | 13179 |
mRNA Refseq | NM_001190451 |
Protein Refseq | NP_001177380 |
UniProt ID | P28654 |
◆ Recombinant Proteins | ||
DCN-1929H | Recombinant Human DCN Protein (Asp31-Lys359), His tagged | +Inquiry |
DCN-2884HF | Recombinant Full Length Human DCN Protein, GST-tagged | +Inquiry |
DCN-82H | Recombinant Human DCN protein, T7/His-tagged | +Inquiry |
Dcn-2475M | Recombinant Mouse Dcn Protein, Myc/DDK-tagged | +Inquiry |
DCN-73H | Recombinant Human DCN protein(Asp31-Lys359), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *