Recombinant Mouse DEFB4 Protein (23-63 aa), His-SUMO-tagged
Cat.No. : | DEFB4-1953M |
Product Overview : | Recombinant Mouse DEFB4 Protein (23-63 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-63 aa |
Description : | Has bactericidal activity |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 20.6 kDa |
AA Sequence : | QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Defb4 defensin beta 4 [ Mus musculus ] |
Official Symbol | DEFB4 |
Synonyms | DEFB4; defensin beta 4; beta-defensin 4; BD-4; 2310001F05Rik; |
Gene ID | 56519 |
mRNA Refseq | NM_019728 |
Protein Refseq | NP_062702 |
UniProt ID | P82019 |
◆ Recombinant Proteins | ||
DEFB4-18H | Active Recombinant Human DEFB4 protein(1-50aa) | +Inquiry |
Defb4-8655R | Active Recombinant Rat Defb4 | +Inquiry |
DEFB4-1953M | Recombinant Mouse DEFB4 Protein (23-63 aa), His-SUMO-tagged | +Inquiry |
DEFB4-1838R | Recombinant Rat DEFB4 Protein | +Inquiry |
DEFB4-1496R | Recombinant Rat DEFB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB4 Products
Required fields are marked with *
My Review for All DEFB4 Products
Required fields are marked with *