Recombinant Mouse DEFB4 Protein (23-63 aa), His-SUMO-tagged
| Cat.No. : | DEFB4-1953M |
| Product Overview : | Recombinant Mouse DEFB4 Protein (23-63 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 23-63 aa |
| Description : | Has bactericidal activity |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 20.6 kDa |
| AA Sequence : | QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Defb4 defensin beta 4 [ Mus musculus ] |
| Official Symbol | DEFB4 |
| Synonyms | DEFB4; defensin beta 4; beta-defensin 4; BD-4; 2310001F05Rik; |
| Gene ID | 56519 |
| mRNA Refseq | NM_019728 |
| Protein Refseq | NP_062702 |
| UniProt ID | P82019 |
| ◆ Recombinant Proteins | ||
| Defb4-598R | Recombinant Rat Defb4 protein | +Inquiry |
| DEFB4-1838R | Recombinant Rat DEFB4 Protein | +Inquiry |
| DEFB4-4486M | Recombinant Mouse DEFB4 Protein | +Inquiry |
| DEFB4-18H | Active Recombinant Human DEFB4 protein(1-50aa) | +Inquiry |
| DEFB4-1953M | Recombinant Mouse DEFB4 Protein (23-63 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB4 Products
Required fields are marked with *
My Review for All DEFB4 Products
Required fields are marked with *
