"DEFB4" Related Products

Recombinant Mouse DEFB4 Protein (23-63 aa), His-SUMO-tagged

Cat.No. : DEFB4-1953M
Product Overview : Recombinant Mouse DEFB4 Protein (23-63 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
Description : Has bactericidal activity
Source : E. coli
Species : Mouse
Tag : His-SUMO
Form : Tris-based buffer,50% glycerol
Molecular Mass : 20.6 kDa
Protein length : 23-63 aa
AA Sequence : QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : Defb4 defensin beta 4 [ Mus musculus ]
Official Symbol : DEFB4
Synonyms : DEFB4; defensin beta 4; beta-defensin 4; BD-4; 2310001F05Rik;
Gene ID : 56519
mRNA Refseq : NM_019728
Protein Refseq : NP_062702
UniProt ID : P82019

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.