Recombinant Mouse DEFB4 Protein (23-63 aa), His-SUMO-tagged

• Cat.No.: DEFB4-1953M
• Product Overview: Recombinant Mouse DEFB4 Protein (23-63 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 23-63 aa
• Description: Has bactericidal activity
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.6 kDa
• AA Sequence: QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Defb4 defensin beta 4 [ Mus musculus ]
• Official Symbol: DEFB4
• Synonyms: DEFB4; defensin beta 4; beta-defensin 4; BD-4; 2310001F05Rik
• Gene ID: 56519
• mRNA Refseq: NM_019728
• Protein Refseq: NP_062702
• UniProt ID: P82019