Recombinant Mouse EBI3 Subunit (IL-27/IL-35) Protein
Cat.No. : | Ebi3-73M |
Product Overview : | Recombinant Mouse EBI3 Subunit (IL-27/IL-35) Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Epstein-Barr virus induced gene 3 (EBI3) is a secreted glycoprotein belonging to the hematopoietin receptor family related to the p40 subunit of interleukin 12 (IL-12). EBI3 expression is induced in B-lymphocytes in response to Epstein-Barr virus infection. EBI3 forms heterodimers with p28 to form interleukin 27 (IL-27), and with p35 to form interleukin 35 (IL-35). Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 23 kDa (207 aa) |
AA Sequence : | MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥90%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile 20 mM HCl at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Ebi3 Epstein-Barr virus induced gene 3 [ Mus musculus (house mouse) ] |
Official Symbol | Ebi3 |
Synonyms | EBI3; Epstein-Barr virus induced gene 3; interleukin-27 subunit beta; IL-27B; IL-27 subunit beta; epstein-Barr virus-induced gene 3 protein homolog; EBI-3; IL-27; |
Gene ID | 50498 |
mRNA Refseq | NM_015766 |
Protein Refseq | NP_056581 |
UniProt ID | O35228 |
◆ Recombinant Proteins | ||
EBI3-504H | Active Recombinant Human Epstein-Barr Virus Induced 3 | +Inquiry |
EBI3-71H | Recombinant Human EBI3 subunit (IL-27/IL-35) Protein | +Inquiry |
EBI3-4135H | Recombinant Human Epstein-Barr Virus Induced 3, His-tagged | +Inquiry |
EBI3-2233H | Recombinant Human EBI3 Protein, GST-tagged | +Inquiry |
EBI3-287H | Recombinant Human EBI3, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ebi3 Products
Required fields are marked with *
My Review for All Ebi3 Products
Required fields are marked with *
0
Inquiry Basket