Recombinant Mouse Echs1 protein, His&Myc-tagged
| Cat.No. : | Echs1-2328M | 
| Product Overview : | Recombinant Mouse Echs1 protein(Q8BH95)(28-290aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse | 
| Source : | Insect Cells | 
| Tag : | His&Myc | 
| Protein Length : | 28-290aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 32.4 kDa | 
| AA Sequence : | ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQSAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | Echs1 enoyl Coenzyme A hydratase, short chain, 1, mitochondrial [ Mus musculus ] | 
| Official Symbol | Echs1 | 
| Synonyms | ECHS1; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial; enoyl-CoA hydratase, mitochondrial; SCEH; enoyl-CoA hydratase 1; short chain enoyl-CoA hydratase; short-chain enoyl-CoA hydratase; C80529; | 
| Gene ID | 93747 | 
| mRNA Refseq | NM_053119 | 
| Protein Refseq | NP_444349 | 
| ◆ Recombinant Proteins | ||
| ECHS1-1661R | Recombinant Rat ECHS1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Echs1-4607M | Recombinant Mouse Echs1 protein, His&Myc-tagged | +Inquiry | 
| ECHS1-3034H | Recombinant Human ECHS1 Protein, GST-tagged | +Inquiry | 
| ECHS1-4170HF | Recombinant Full Length Human ECHS1 Protein, GST-tagged | +Inquiry | 
| ECHS1-2811H | Recombinant Human ECHS1, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ECHS1-528HCL | Recombinant Human ECHS1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Echs1 Products
Required fields are marked with *
My Review for All Echs1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            