Recombinant Mouse Egf Protein, His-tagged

Cat.No. : Egf-7197M
Product Overview : Recombinant mouse EGF protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by conventional column chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 977-1029
Description : This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis.
Form : Liquid
Molecular Mass : 8.6 kDa (77aa)
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 2 mM DTT, 10 % glycerol, 100 mM NaCl
Gene Name Egf epidermal growth factor [ Mus musculus (house mouse) ]
Official Symbol Egf
Synonyms Egf; epidermal growth factor; AI790464; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF)
Gene ID 13645
mRNA Refseq NM_001310737
Protein Refseq NP_001297666
UniProt ID Q3UWD7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Egf Products

Required fields are marked with *

My Review for All Egf Products

Required fields are marked with *

0

Inquiry Basket

cartIcon