Recombinant Mouse Eln protein, His-tagged
Cat.No. : | Eln-2845M |
Product Overview : | Recombinant Mouse Eln protein(P54320)(266-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 266-443aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.3 kDa |
AA Sequence : | PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Eln elastin [ Mus musculus ] |
Official Symbol | Eln |
Synonyms | ELN; elastin; tropoelastin; AI385707; AI480567; E030024M20Rik; |
Gene ID | 13717 |
mRNA Refseq | NM_007925 |
Protein Refseq | NP_031951 |
◆ Recombinant Proteins | ||
ELN-3259H | Recombinant Human ELN Protein, GST-tagged | +Inquiry |
ELN-12415H | Recombinant Human ELN, His-tagged | +Inquiry |
ELN-2845H | Recombinant Human ELN Protein, His (Fc)-Avi-tagged | +Inquiry |
ELN-127B | Recombinant Bovine ELN protein, His-tagged | +Inquiry |
ELN-126H | Recombinant Human ELN protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ELN-01H | Active Native Human ELN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELN-550HCL | Recombinant Human ELN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Eln Products
Required fields are marked with *
My Review for All Eln Products
Required fields are marked with *