Recombinant Mouse Esm1 Protein, His-tagged
| Cat.No. : | Esm1-7412M |
| Product Overview : | Recombinant mouse Endocan / ESM1 with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His |
| Description : | Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions. |
| Form : | Lyophilized |
| Molecular Mass : | 19.07 kDa |
| AA Sequence : | WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRTRHHHHHH |
| N-terminal Sequence Analysis : | WSAKYAVD |
| Purity : | > 95 % by SDS-PAGE and Silver staining |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Prior to reconstitution store at 2-8 centigrade. Following reconstitution store undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade for longer. Avoid repeated freezing and thawing. |
| Storage Buffer : | H2O |
| Reconstitution : | Restore in water to a concentration of 0.1 mg/mL. |
| Gene Name | Esm1 endothelial cell-specific molecule 1 [ Mus musculus (house mouse) ] |
| Official Symbol | Esm1 |
| Synonyms | Esm1; endothelial cell-specific molecule 1; ESM-1; AV004503; 0610042H23Rik; endothelial cell-specific molecule 1 |
| Gene ID | 71690 |
| mRNA Refseq | NM_023612 |
| Protein Refseq | NP_076101 |
| UniProt ID | Q9QYY7 |
| ◆ Recombinant Proteins | ||
| ESM1-3500H | Recombinant Human ESM1 Protein, GST-tagged | +Inquiry |
| Esm1-709R | Recombinant Rat Esm1 Protein, His-tagged | +Inquiry |
| ESM1-4577Z | Recombinant Zebrafish ESM1 | +Inquiry |
| Esm1-476M | Active Recombinant Mouse Endothelial Cell-Specific Molecule 1, His-tagged | +Inquiry |
| Esm1-2871M | Recombinant Mouse Esm1 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
| ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Esm1 Products
Required fields are marked with *
My Review for All Esm1 Products
Required fields are marked with *
