Recombinant Mouse Esm1 Protein, His-tagged
Cat.No. : | Esm1-7412M |
Product Overview : | Recombinant mouse Endocan / ESM1 with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Description : | Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions. |
Form : | Lyophilized |
Molecular Mass : | 19.07 kDa |
AA Sequence : | WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRTRHHHHHH |
N-terminal Sequence Analysis : | WSAKYAVD |
Purity : | > 95 % by SDS-PAGE and Silver staining |
Stability : | Shelf life: one year from despatch. |
Storage : | Prior to reconstitution store at 2-8 centigrade. Following reconstitution store undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade for longer. Avoid repeated freezing and thawing. |
Storage Buffer : | H2O |
Reconstitution : | Restore in water to a concentration of 0.1 mg/mL. |
Gene Name | Esm1 endothelial cell-specific molecule 1 [ Mus musculus (house mouse) ] |
Official Symbol | Esm1 |
Synonyms | Esm1; endothelial cell-specific molecule 1; ESM-1; AV004503; 0610042H23Rik; endothelial cell-specific molecule 1 |
Gene ID | 71690 |
mRNA Refseq | NM_023612 |
Protein Refseq | NP_076101 |
UniProt ID | Q9QYY7 |
◆ Recombinant Proteins | ||
Esm1-709R | Recombinant Rat Esm1 Protein, His-tagged | +Inquiry |
ESM1-57H | Recombinant Human ESM1 protein, T7/His-tagged | +Inquiry |
ESM1-1806R | Recombinant Rat ESM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Esm1-8703M | Recombinant Mouse ESM1 protein(Met1-Arg184), His-tagged | +Inquiry |
Esm1-708M | Recombinant Mouse Cebpd Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Esm1 Products
Required fields are marked with *
My Review for All Esm1 Products
Required fields are marked with *
0
Inquiry Basket