Recombinant Mouse Esm1 Protein, His-tagged

Cat.No. : Esm1-7412M
Product Overview : Recombinant mouse Endocan / ESM1 with a His tag was expressed in insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Description : Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions.
Form : Lyophilized
Molecular Mass : 19.07 kDa
AA Sequence : WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRTRHHHHHH
N-terminal Sequence Analysis : WSAKYAVD
Purity : > 95 % by SDS-PAGE and Silver staining
Stability : Shelf life: one year from despatch.
Storage : Prior to reconstitution store at 2-8 centigrade.
Following reconstitution store undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade for longer.
Avoid repeated freezing and thawing.
Storage Buffer : H2O
Reconstitution : Restore in water to a concentration of 0.1 mg/mL.
Gene Name Esm1 endothelial cell-specific molecule 1 [ Mus musculus (house mouse) ]
Official Symbol Esm1
Synonyms Esm1; endothelial cell-specific molecule 1; ESM-1; AV004503; 0610042H23Rik; endothelial cell-specific molecule 1
Gene ID 71690
mRNA Refseq NM_023612
Protein Refseq NP_076101
UniProt ID Q9QYY7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Esm1 Products

Required fields are marked with *

My Review for All Esm1 Products

Required fields are marked with *

0
cart-icon
0
compare icon