Recombinant Mouse F3 Protein, His-tagged

Cat.No. : F3-7203M
Product Overview : Recombinant Mouse F3 Protein with a His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Tag : His
Protein Length : 29-251
Description : This gene encodes a membrane-bound glycoprotein that forms the primary physiological initiator of the blood coagulation process following vascular damage. The encoded protein binds to coagulation factor VIIa and the ensuing complex catalyzes the proteolytic activation of coagulation factors IX and X. Mice lacking encoded protein die in utero resulting from massive hemorrhaging in both extraembryonic and embryonic vessels. A severe deficiency of the encoded protein in mice results in impaired uterine homeostasis, shorter life spans due to spontaneous fatal hemorrhages and cardiac fibrosis.
Form : Liquid
Molecular Mass : 26.4 kDa
AA Sequence : ADPAGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGEHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name F3 coagulation factor III [ Mus musculus (house mouse) ]
Official Symbol F3
Synonyms F3; coagulation factor III; TF; Cf3; Cf-3; CD142; AA409063; tissue factor
Gene ID 14066
mRNA Refseq NM_010171
Protein Refseq NP_034301
UniProt ID P20352

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All F3 Products

Required fields are marked with *

My Review for All F3 Products

Required fields are marked with *

0
cart-icon