Recombinant Mouse FAIM3 Protein (18-262 aa), His-SUMO-tagged
Cat.No. : | FAIM3-495M |
Product Overview : | Recombinant Mouse FAIM3 Protein (18-262 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 18-262 aa |
Description : | May play a role in the immune syst processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Ses to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 43.9 kDa |
AA Sequence : | RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Faim3 Fas apoptotic inhibitory molecule 3 [ Mus musculus ] |
Official Symbol | FAIM3 |
Synonyms | FAIM3; Toso; 1810037B05Rik; MGC144825; MGC144826; |
Gene ID | 69169 |
mRNA Refseq | NM_026976 |
Protein Refseq | NP_081252 |
UniProt ID | A1KXC4 |
◆ Recombinant Proteins | ||
FAIM3-1546R | Recombinant Rhesus monkey FAIM3 Protein, His-tagged | +Inquiry |
FAIM3-1371R | Recombinant Rhesus Macaque FAIM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAIM3-2941M | Recombinant Mouse FAIM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAIM3-277H | Recombinant Human FAIM3, Fc-tagged | +Inquiry |
FAIM3-2202R | Recombinant Rat FAIM3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAIM3-753HCL | Recombinant Human FAIM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAIM3 Products
Required fields are marked with *
My Review for All FAIM3 Products
Required fields are marked with *
0
Inquiry Basket