Recombinant Mouse Fam3b protein, His&Myc-tagged
| Cat.No. : | Fam3b-4247M |
| Product Overview : | Recombinant Mouse Fam3b protein(Q9D309)(30-235aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 30-235aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.8 kDa |
| AA Sequence : | ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Fam3b family with sequence similarity 3, member B [ Mus musculus ] |
| Official Symbol | Fam3b |
| Synonyms | FAM3B; family with sequence similarity 3, member B; protein FAM3B; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; ORF9; Pander; D16Jhu19e; 9030624C24Rik; |
| Gene ID | 52793 |
| mRNA Refseq | NM_020622 |
| Protein Refseq | NP_065647 |
| ◆ Recombinant Proteins | ||
| Fam3b-2938M | Recombinant Mouse Fam3b Protein, Myc/DDK-tagged | +Inquiry |
| FAM3B-7846H | Recombinant Human FAM3B protein, His-tagged | +Inquiry |
| FAM3B-358H | Recombinant Human FAM3B Protein, MYC/DDK-tagged | +Inquiry |
| FAM3B-3673H | Recombinant Human FAM3B, His-tagged | +Inquiry |
| FAM3B-97H | Recombinant Human FAM3B protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM3B-1648HCL | Recombinant Human FAM3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fam3b Products
Required fields are marked with *
My Review for All Fam3b Products
Required fields are marked with *



