Recombinant Human FAM3B protein
Cat.No. : | FAM3B-97H |
Product Overview : | Recombinant human FAM3B cDNA 30 - 235 aa, Isoform-a, derived from BC057829) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 30-235 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGELIPDAPL SSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIA IVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSS WVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human FAM3B mediated metabolic pathway regulation study for pancreatic beta cell, adipocytes and hepatocytes with this protein as either coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | FAM3B family with sequence similarity 3, member B [ Homo sapiens ] |
Official Symbol | FAM3B |
Synonyms | FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; |
Gene ID | 54097 |
mRNA Refseq | NM_058186 |
Protein Refseq | NP_478066 |
MIM | 608617 |
UniProt ID | P58499 |
Chromosome Location | 21q22.3 |
Function | cytokine activity; |
◆ Recombinant Proteins | ||
FAM3B-7846H | Recombinant Human FAM3B protein, His-tagged | +Inquiry |
FAM3B-2029H | Recombinant Human FAM3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM3B-97H | Recombinant Human FAM3B protein | +Inquiry |
Fam3b-1054M | Recombinant Mouse Fam3b protein, hFc-tagged | +Inquiry |
FAM3B-3657H | Recombinant Human FAM3B Protein (Glu30-Ser187), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3B-1648HCL | Recombinant Human FAM3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3B Products
Required fields are marked with *
My Review for All FAM3B Products
Required fields are marked with *