Recombinant Mouse Fan1 protein, His&Myc-tagged
| Cat.No. : | Fan1-6332M |
| Product Overview : | Recombinant Mouse Fan1 protein(Q69ZT1)(893-1020aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 893-1020a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | IHSAPAESLRAWVGEAWQAQQGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRRLAADFRHCRGGLPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLYELQKLGADVEVCHVVAVGAKSKGLG |
| Gene Name | Fan1 FANCD2/FANCI-associated nuclease 1 [ Mus musculus ] |
| Official Symbol | Fan1 |
| Synonyms | FAN1; FANCD2/FANCI-associated nuclease 1; fanconi-associated nuclease 1; myotubularin related protein 15; myotubularin-related protein 15; coiled-coil domain-containing protein MTMR15; Mtmr15; 6030441H18Rik; |
| Gene ID | 330554 |
| mRNA Refseq | NM_177893 |
| Protein Refseq | NP_808561 |
| ◆ Recombinant Proteins | ||
| FAN1-5666M | Recombinant Mouse FAN1 Protein | +Inquiry |
| Fan1-6332M | Recombinant Mouse Fan1 protein, His&Myc-tagged | +Inquiry |
| FAN1-564G | Recombinant Giant panda FAN1 protein, His&Myc-tagged | +Inquiry |
| FAN1-3109M | Recombinant Mouse FAN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAN1-4133Z | Recombinant Zebrafish FAN1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAN1-911HCL | Recombinant Human FAN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fan1 Products
Required fields are marked with *
My Review for All Fan1 Products
Required fields are marked with *
