"Fap" Related Products

Expand

Recombinant Mouse Fap protein, His-tagged

Cat.No.: FAP-584M
Product Overview: Recombinant Mouse Fap fused with His tag was expressed in HEK293F.
Description: This gene belongs to the serine protease family. The encoded protein is an inducible cell-surface bound glycoprotein specifically expressed in tumor-associated fibroblasts and pericytes of epithelial tumors and has protease and gelatinase activity. The protein plays a role in remodeling of the extracellular matrix (ECM) and may affect tumorigenesis and tissue repair. Alternately spliced transcript variants of this gene are described in the literature (PMID 9139873), but the full-length sequence of these variants is not available.
Source: HEK293F
Species: Mouse
Tag: His
Form: Lyophilized from sterile 25mM Tris, 250mM NaCl, pH 8.2
Bio-activity: The specific activity(kcat)is >1000 pmol/min/μg. kcat/Km>0.5×10E4 (M^-1s^-1)Measured by its ability to convert the substrate ZGPAMC to ZGlyPro and AMC.
Molecular Mass: ~90 kDa
AA Sequence: HHHHHHHHHHENLYFQLRPSRVYKPEGNTKRALTLKDILNGTFSYKTYFPNWISEQEYLHQSEDDNIVFYNIETR ESYIILSNSTMKSVNATDYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLQNGEFVRGYELPRPIQYLCWSPVG SKLAYVYQNNIYLKQRPGDPPFQITYTGRENRIFNGIPDWVYEEEMLATKYALWWSPDGKFLAYVEFNDSDIPII AYSYYGDGQYPRTINIPYPKAGAKNPVVRVFIVDTTYPHHVGPMEVPVPEMIASSDYYFSWLTWVSSERVCLQWL KRVQNVSVLSICDFREDWHAWECPKNQEHVEESRTGWAGGFFVSTPAFSQDATSYYKIFSDKDGYKHIHYIKDTV ENAIQITSGKWEAIYIFRVTQDSLFYSSNEFEGYPGRRNIYRISIGNSPPSKKCVTCHLRKERCQYYTASFSYKA KYYALVCYGPGLPISTLHDGRTDQEIQVLEENKELENSLRNIQLPKVEIKKLKDGGLTFWYKMILPPQFDRSKKY PLLIQVYGGPCSQSVKSVFAVNWITYLASKEGIVIALVDGRGTAFQGDKFLHAVYRKLGVYEVEDQLTAVRKFIE MGFIDEERIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASIYSERFMGLPTKDDNLEHYKNSTVMA RAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGISSGRSQNHLYTHMTHFLKQCFSL SD
Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method
Purity: >95%, by SDS-PAGE under reducing conditions
Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Gene Name: Fap fibroblast activation protein [ Mus musculus ]
Official Symbol: Fap
Synonyms: FAP; fibroblast activation protein; seprase; integral membrane serine protease; fibroblast activation protein alpha;
Gene ID: 14089
mRNA Refseq: NM_007986
Protein Refseq: NP_032012
MIM:
UniProt ID: P97321
Chromosome Location: 2 C1.3; 2 35.85 cM
Function: endopeptidase activity; hydrolase activity; peptidase activity; peptidase activity; protease binding; serine-type endopeptidase activity; serine-type peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.