Recombinant Mouse FBXW10 Protein (701-1030 aa), His-SUMO-tagged
Cat.No. : | FBXW10-2132M |
Product Overview : | Recombinant Mouse FBXW10 Protein (701-1030 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 701-1030 aa |
Description : | Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1 (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.2 kDa |
AA Sequence : | VKWQYSSDKNKVKKSKDKEEEREETSLGDEHSRSTIQGHSLKDSVSSKQEFSKSRVHLKQTKNLSSDDMETPVGEVSHPLQKLWKVPMTPDRFLLTISALQQAHNSEEFAYPHRPRPQVIDAWGPSIPYPRKVLSLKGKSVQHAVDQLRSSNLPTGVRQTNIPLEIQKLQPNLKKSLHSPRVQATVPQPSLIRPKVSDSLRGDEHLTSSIDGTMRRAGPLTSMQVIKPNRMLAPRGGTATLSPKKERPRFYTTLDPLRMNTGFMLMTVKEEKEFAEAKMKEYEASVSTKEVDPGKASKAAWIRKIKGLPIDNFMKEGKTAAPELGQNVFI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Fbxw10 F-box and WD-40 domain protein 10 [ Mus musculus (house mouse) ] |
Official Symbol | FBXW10 |
Synonyms | HREP; Fbw10; SM25H2; SM2SH2; |
Gene ID | 213980 |
UniProt ID | Q5SUS0 |
◆ Recombinant Proteins | ||
FBXW10-2132M | Recombinant Mouse FBXW10 Protein (701-1030 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXW10 Products
Required fields are marked with *
My Review for All FBXW10 Products
Required fields are marked with *
0
Inquiry Basket