Recombinant Mouse Fcgr3 protein, His-SUMO-tagged
Cat.No. : | Fcgr3-4137M |
Product Overview : | Recombinant Mouse Fcgr3 protein(P08508)(31-215aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 31-215aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Fcgr3 Fc receptor, IgG, low affinity III [ Mus musculus ] |
Official Symbol | Fcgr3 |
Synonyms | FCGR3; Fc receptor, IgG, low affinity III; low affinity immunoglobulin gamma Fc region receptor III; fcRIII; FcgammaRIII; fc-gamma RIII; Fcg receptor III; igG Fc receptor III; Fc gamma receptor III; CD16; |
Gene ID | 14131 |
mRNA Refseq | NM_010188 |
Protein Refseq | NP_034318 |
◆ Recombinant Proteins | ||
FCGR3-1457M | Active Recombinant Mouse FCGR3 protein, His-tagged | +Inquiry |
FCGR3-411R | Active Recombinant Rhesus FCGR3 protein, His/Avi-tagged, Biotinylated | +Inquiry |
FCGR3-288C | Recombinant Cynomolgus FCGR3 protein, His-tagged, Biotinylated | +Inquiry |
Fcgr3-4025M | Active Recombinant Mouse Fcgr3 protein(Met1-Thr215), His-tagged | +Inquiry |
FCGR3-1112M | Recombinant Mouse FCGR3 Protein (Met1-Thr215), His-AVI-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR3-1992CCL | Recombinant Cynomolgus FCGR3 cell lysate | +Inquiry |
FCGR3-2090MCL | Recombinant Mouse FCGR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fcgr3 Products
Required fields are marked with *
My Review for All Fcgr3 Products
Required fields are marked with *