Recombinant Mouse Fcgr3 protein, His-SUMO-tagged
| Cat.No. : | Fcgr3-4137M |
| Product Overview : | Recombinant Mouse Fcgr3 protein(P08508)(31-215aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 31-215aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.2 kDa |
| AA Sequence : | ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Fcgr3 Fc receptor, IgG, low affinity III [ Mus musculus ] |
| Official Symbol | Fcgr3 |
| Synonyms | FCGR3; Fc receptor, IgG, low affinity III; low affinity immunoglobulin gamma Fc region receptor III; fcRIII; FcgammaRIII; fc-gamma RIII; Fcg receptor III; igG Fc receptor III; Fc gamma receptor III; CD16; |
| Gene ID | 14131 |
| mRNA Refseq | NM_010188 |
| Protein Refseq | NP_034318 |
| ◆ Recombinant Proteins | ||
| Fcgr3-488M | Active Recombinant Mouse Fc Receptor, LgG, Low Affinity III, His-tagged | +Inquiry |
| Fcgr3-5663M | Recombinant Mouse Fcgr3 Protein (Ala31-Thr215), C-His tagged | +Inquiry |
| FCGR3-283C | Recombinant Cynomolgus FCGR3 protein, His-tagged | +Inquiry |
| FCGR3-284C | Active Recombinant Cynomolgus FCGR3 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
| FCGR3-437C | Recombinant Cynomolgus FCGR3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGR3-2090MCL | Recombinant Mouse FCGR3 cell lysate | +Inquiry |
| FCGR3-1992CCL | Recombinant Cynomolgus FCGR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fcgr3 Products
Required fields are marked with *
My Review for All Fcgr3 Products
Required fields are marked with *
