Recombinant Mouse Fgf15 Protein, His-tagged

• Cat.No.: Fgf15-01M
• Product Overview: Recombinant mature mouse FGF-15 (Arg26-Lys218) with a 6×His tag at the N-Terminus was expressed in E. coli. This protein was purified by Ni-NTA column

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 26-218
• Description: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression.
• Molecular Mass: 24.7 kDa
• AA Sequence: 26RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK218
• Purity: > 95% by SDS-PAGE
• Applications: ELISA
• Storage: Store lyophilized protein at -20 or -70 centigrade. Lyophilized protein is stable for up to 6 months from date of receipt at -20 to -70 centigrade.
  Upon reconstitution, this protein can be stored at -20 centigrade for a few weeks or at -70 centigrade in a manual defrost freezer for long term storage (six months). Aliquot reconstituted protein to avoid repeated freezing/thawing cycles.
• Storage Buffer: Lyophilized 100 μg of Mouse FGF-15 in 100 μL of PBS. Carry free.
• Reconstitution: Add 500 μL TBS to the vial to prepare a working stock solution at 200 μg/mL. Allow to set at least 30 minutes at 4 centigrade, mix well.

Gene Information

• Gene Name: Fgf15 fibroblast growth factor 15 [ Mus musculus (house mouse) ]
• Official Symbol: Fgf15
• Synonyms: Fgf15; fibroblast growth factor 15; FGF19; Fgf8a; fibroblast growth factor 15; FGF-15; fibroblast growth factor 8a
• Gene ID: 14170
• mRNA Refseq: NM_008003
• Protein Refseq: NP_032029
• UniProt ID: O35622