Recombinant Mouse Fgf17 protein
Cat.No. : | Fgf17-8333M |
Product Overview : | Recombinant Mouse Fgf17 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 194 |
Description : | FGF-17 is a member of the FGF superfamily of heparin-binding mitogenic molecules characterized by the presence of a core, 120 amino acid (aa) beta-trefoil structure. The mRNA of FGF-17 was found in midgestation of embryo and multiple adult tissues, and is preferentially expressed in specific sites, such as embryonic brain, developing skeleton and arteries. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.0, 700 mM NaCl, with 0.02 % Tween-20. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg in the presence of 10 μg/ml of heparin. |
Molecular Mass : | Approximately 22.5 kDa, a single non-glycosylated polypeptide chain containing 194 amino acids. |
AA Sequence : | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT |
Endotoxin : | Less than 0.1 EU/µg of rMuFGF-17 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile PBS to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Fgf17 |
Official Symbol | Fgf17 |
Synonyms | FGF17; fibroblast growth factor 17; FGF-17; |
Gene ID | 14171 |
mRNA Refseq | NM_008004 |
Protein Refseq | NP_032030 |
UniProt ID | P63075 |
◆ Recombinant Proteins | ||
FGF17-4815HF | Recombinant Full Length Human FGF17 Protein, GST-tagged | +Inquiry |
FGF17-3224H | Recombinant Human FGF17 Protein (Thr23-Gly199), His tagged | +Inquiry |
FGF17-12818Z | Recombinant Zebrafish FGF17 | +Inquiry |
FGF17-156H | Recombinant Human FGF17 Protein, His-tagged | +Inquiry |
FGF17-3223H | Recombinant Human FGF17 Protein (Thr23-Thr216), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF17-6245HCL | Recombinant Human FGF17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fgf17 Products
Required fields are marked with *
My Review for All Fgf17 Products
Required fields are marked with *
0
Inquiry Basket