Recombinant Mouse Fgf21 Protein, His-tagged

• Cat.No.: Fgf21-7399M
• Product Overview: Recombinant Mouse Fgf21 protein with a His tag was expressed in insect cells.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 29-210
• Description: Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB.
• Form: Liquid
• Molecular Mass: 21.0 kDa
• AA Sequence: AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYASLEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Fgf21 fibroblast growth factor 21 [ Mus musculus (house mouse) ]
• Official Symbol: Fgf21
• Synonyms: Fgf21; fibroblast growth factor 21; Fgf8c; fibroblast growth factor 21; fibroblast growth factor 8c
• Gene ID: 56636
• mRNA Refseq: NM_020013
• Protein Refseq: NP_064397
• UniProt ID: Q9JJN1