Recombinant Mouse Fgf21 Protein, His-tagged
| Cat.No. : | Fgf21-7399M |
| Product Overview : | Recombinant Mouse Fgf21 protein with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 29-210 |
| Description : | Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB. |
| Form : | Liquid |
| Molecular Mass : | 21.0 kDa |
| AA Sequence : | AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYASLEHHHHHH |
| Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
| Purity : | > 90 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
| Gene Name | Fgf21 fibroblast growth factor 21 [ Mus musculus (house mouse) ] |
| Official Symbol | Fgf21 |
| Synonyms | Fgf21; fibroblast growth factor 21; Fgf8c; fibroblast growth factor 21; fibroblast growth factor 8c |
| Gene ID | 56636 |
| mRNA Refseq | NM_020013 |
| Protein Refseq | NP_064397 |
| UniProt ID | Q9JJN1 |
| ◆ Recombinant Proteins | ||
| FGF21-626B | Recombinant Bovine Fibroblast Growth Factor 21 | +Inquiry |
| Fgf21-257M | Active Recombinant Mouse Fgf21 Protein (Ala29-Ser210), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| Fgf21-193M | Recombinant Mouse Fgf21 protein, His/S-tagged | +Inquiry |
| Fgf21-574M | Recombinant Mouse Fgf21 protein, His-tagged | +Inquiry |
| FGF21-1966H | Recombinant Human FGF21 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fgf21 Products
Required fields are marked with *
My Review for All Fgf21 Products
Required fields are marked with *
