Recombinant Mouse Fgf5 protein, His&Myc-tagged
Cat.No. : | Fgf5-8964M |
Product Overview : | Recombinant Mouse Fgf5 protein(P15656)(21-264aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 21-264aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVKPKVPLSQPRRSPSPVKYRLKFRFG |
Gene Name | Fgf5 fibroblast growth factor 5 [ Mus musculus ] |
Official Symbol | Fgf5 |
Synonyms | FGF5; fibroblast growth factor 5; HBGF-5; heparin-binding growth factor 5; go; Fgf-5; angora; |
Gene ID | 14176 |
mRNA Refseq | NM_010203 |
Protein Refseq | NP_034333 |
◆ Recombinant Proteins | ||
Fgf5-876M | Recombinant Mouse Fgf5 protein, His-tagged | +Inquiry |
FGF5-97H | Active Recombinant Human FGF5 Protein (Ala18-Gly268), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF5-1991R | Recombinant Rat FGF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF5-172H | Recombinant Human Fibroblast Growth Factor 5 | +Inquiry |
FGF5-3236M | Recombinant Mouse FGF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF5-6239HCL | Recombinant Human FGF5 293 Cell Lysate | +Inquiry |
FGF5-6238HCL | Recombinant Human FGF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf5 Products
Required fields are marked with *
My Review for All Fgf5 Products
Required fields are marked with *
0
Inquiry Basket