Recombinant Mouse Fgf7 protein
| Cat.No. : | Fgf7-649M |
| Product Overview : | Recombinant Mouse Fgf7 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 163 |
| Description : | Murine KGF-1 also known as Fibroblast growth factor 7 (FGF-7), is encoded by the FGF7 gene. KGF-1 only binds to the b splice form of the tyrosine kinase receptor, FGFR2b/KGFR. Affinity between KGF-1 and its receptor can be increased by heparin or heparan sulfate proteoglycan. FGF-10, also called keratinocyte growth factor 2 (KGF-2), shares 51 % amino acid sequence identity and similar function to KGF-1, but uses an additional receptor, FGFR2c. KGF-1 plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. KGF-1 actives on keratinocytes, and exhibits mitogenic activity for epidermal cells, but essentially no activity for fibroblasts. KGF-1 has species crossactive, murine KGF-1 shares 96 % amino acid sequence identity with human and rat. |
| Form : | Lyophilized from a 0.2μm filtered solution in 20 mM PB, pH 8.0, 1 M NaCl. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg. |
| Molecular Mass : | Approximately 18.7 kDa, a single, non-glycosylated polypeptide chain containing 163 amino acids. |
| AA Sequence : | CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT |
| Endotoxin : | Less than 1 EU/µg of rMuKGF-1/FGF-7 as determined by LAL method. |
| Purity : | >96% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | Fgf7 |
| Official Symbol | Fgf7 |
| Synonyms | FGF7; fibroblast growth factor 7; FGF-7; HBGF-7; Keratinocyte growth factor; heparin-binding growth factor 7; Kgf; |
| Gene ID | 14178 |
| mRNA Refseq | NM_008008 |
| Protein Refseq | NP_032034 |
| UniProt ID | P36363 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fgf7 Products
Required fields are marked with *
My Review for All Fgf7 Products
Required fields are marked with *
