Recombinant Mouse Fos protein(1-380aa), His-tagged
Cat.No. : | Fos-1639M |
Product Overview : | Recombinant Mouse Fos protein(P01101)(1-380aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-380aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFTLPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYAADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL |
Gene Name | Fos FBJ osteosarcoma oncogene [ Mus musculus ] |
Official Symbol | Fos |
Synonyms | FOS; FBJ osteosarcoma oncogene; proto-oncogene c-Fos; cellular oncogene fos; proto-oncogene protein c-fos; cFos; c-fos; D12Rfj1; |
Gene ID | 14281 |
mRNA Refseq | NM_010234 |
Protein Refseq | NP_034364 |
◆ Recombinant Proteins | ||
FOS-32H | Recombinant Human FOS protein, GST-tagged | +Inquiry |
FOS404H | Recombinant Human FOS Protein, His-tagged | +Inquiry |
FOS-27240TH | Recombinant Human FOS, His-tagged | +Inquiry |
FOS-5971M | Recombinant Mouse FOS Protein | +Inquiry |
FOS-3339H | Recombinant Human FOS Protein (Met1-Leu380), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOS-6168HCL | Recombinant Human FOS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fos Products
Required fields are marked with *
My Review for All Fos Products
Required fields are marked with *
0
Inquiry Basket