Recombinant Mouse FPR1 Protein (1-35 aa), His-GST-Myc-tagged
Cat.No. : | FPR1-2444M |
Product Overview : | Recombinant Mouse FPR1 Protein (1-35 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 1-35 aa |
Description : | High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.7 kDa |
AA Sequence : | MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Fpr1 formyl peptide receptor 1 [ Mus musculus ] |
Official Symbol | FPR1 |
Synonyms | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; fMLP receptor; lipoxin A4 receptor; FPR; LXA4R; fMLF-R; |
Gene ID | 14293 |
mRNA Refseq | NM_013521 |
Protein Refseq | NP_038549 |
UniProt ID | P33766 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR1 Products
Required fields are marked with *
My Review for All FPR1 Products
Required fields are marked with *
0
Inquiry Basket